Cagrilintide (5mg) is a synthetic peptide analog designed to replicate specific structural and signaling characteristics of the naturally occurring hormone amylin. The Cagrilintide peptide belongs to a class of engineered compounds studied for their effects on metabolic regulation and endocrine activity. It has a molecular weight of 4,409 g/mol and is produced through controlled peptide synthesis to ensure high analytical purity suitable for laboratory investigation.

In research settings, Cagrilintide is supplied as a lyophilized powder in a sterile 5 mg vial, enabling precise preparation according to defined experimental protocols. This format supports accurate reconstitution and controlled handling in laboratory environments. Current research explores how amylin-related peptide analogs interact with biological systems involved in metabolic signaling, cellular communication, and energy balance.

Additional investigations examine how this peptide behaves under varying experimental conditions, including concentration, exposure duration, and model systems. These studies aim to better understand its role in coordinated signaling processes that influence metabolic pathways and cellular responses while remaining within strictly controlled research settings.

Cagrilintide (5mg) Key Features & Specs

Cagrilintide is prepared for use in controlled laboratory environments where consistency and accurate peptide characterization are essential. This peptide is commonly included in studies examining metabolic and endocrine signaling pathways. As part of ongoing Cagrilintide research, it is utilized in structured experimental protocols focused on metabolic system models.

• Subcategory: Weight Loss & Metabolic Peptides
• Strength: 5 mg
• CAS: 1415456-99-3
• Chemical Formula: C₁₉₄H₃₁₂N₅₄O₅₉S₂
• Molecular Weight: 4409 g/mol
• Peptide Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP
• Synonyms: NN0174-0833, AM833, EX-A10092

For laboratory research use only.

Cagrilintide (5mg) Research Uses

Cagrilintide metabolic research focuses on how amylin-related peptide analogs may influence metabolic signaling systems. Researchers examine this compound in experimental models exploring energy balance, appetite-related signaling, and endocrine communication.

Cagrilintide has been studied in models to observe how peptide hormones interact with metabolic tissues and biological systems involved in glucose regulation and energy utilization. Through ongoing research, scientists investigate how peptide-based signaling may influence communication among metabolic tissues, including the pancreas, gastrointestinal tract, and central regulatory structures.

Cagrilintide (5mg) Insights & Observed Findings

Experimental investigations involving Cagrilintide often examine specific exposure levels in laboratory environments to observe measurable metabolic responses. In metabolic research, studies frequently evaluate controlled concentration ranges to assess laboratory indicators, including metabolic signaling markers, cellular activity patterns, and gene expression responses.

Published research reports describe experimental settings where researchers measure changes in metabolic biomarkers and cellular signaling responses under controlled conditions.

Cagrilintide (5mg) Handling & Storage

Cagrilintide is supplied as a lyophilized peptide powder for laboratory preparation. Recommended handling practices include:

• Storage: Store at –20°C in a controlled laboratory freezer.
• Protection: Protect the material from light, heat, and moisture during storage.
• Pre-opening: Allow the vial to reach room temperature before opening to minimize condensation.
• Reconstitution: Reconstitute using sterile laboratory-grade solvent according to experimental protocols.
• Post-reconstitution: Use prepared solution promptly according to experimental protocols.

Proper storage and handling support peptide integrity during research procedures.

Compliance Notice: This product is intended for laboratory research use only and is not approved for human or veterinary use. It is not intended for diagnostic, therapeutic, or clinical applications. Any reference to biological activity or potential effects is based solely on preclinical or in-vitro findings and should not be interpreted as validated clinical outcomes. Researchers are responsible for ensuring proper handling, storage, and disposal in accordance with institutional, federal, and international guidelines.

References

1. D'Ascanio AM, Mullally JA, Frishman WH. Cagrilintide: A Long-Acting Amylin Analog for the Treatment of Obesity. Cardiol Rev. 2024;32(1):83-90. doi:10.1097/CRD.0000000000000513
2. Lau DCW, Erichsen L, Francisco AM, et al. Once-weekly cagrilintide for weight management in people with overweight and obesity: a multicentre, randomised, double-blind, placebo-controlled and active-controlled, dose-finding phase 2 trial. Lancet. 2021;398(10317):2160-2172. doi:10.1016/S0140-6736(21)01751-7
3. Dutta D, Nagendra L, Harish BG, et al. Efficacy and Safety of Cagrilintide Alone and in Combination with Semaglutide (Cagrisema) as Anti-Obesity Medications: A Systematic Review and Meta-Analysis. Indian J Endocrinol Metab. 2024;28(5):436-444. doi:10.4103/ijem.ijem_45_24
4. Kruse T, Hansen JL, Dahl K, et al. Development of Cagrilintide, a Long-Acting Amylin Analogue. J Med Chem. 2021;64(15):11183-11194. doi:10.1021/acs.jmedchem.1c00565